Familyfriendlyreviewsandgiveaways.com - Site details and information
familyfriendlyreviewsandgiveaways.com is a WordPress site. See analytics, data, income and site value estimation below.
Do you want a valuable free backlink to your site? Join us!
Domain name | familyfriendlyreviewsandgiveaways.com |
Votes | 1 3 1 |
Created on | 05/30/2018 |
Google Analytics | |
Adsense | |
Amazon Affiliate | |
Alexa rank | 16538533 |
Alexa backlinks | - |
Site value | |
Themes | genesis |
twenty-seven-pro | |
Free theme | |
Plugins | lightweight-social-icons |
social-warfare | |
Keywords |
provide complete | chips | disclosure | giveaways | opinions | 3 boys | sponsorships | purchased | influenced | strictly | highlighters | strive | pencils |