Below is a collection of websites that have content with the noticed keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

Domain name | lifeobservator.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 05/13/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | independent-publisher-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
custom-fonts | |
Keywords |
life experience | emotional | emotions | personalities | observation | subconsciously | relationships | learnt | childhood | subconscious | poland | therapy | managed | actions | surrounded | noticed | opinion |

Domain name | throughthefoodportal.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 09/10/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | rosalie |
Plugins | google-analytics-for-wordpress |
jetpack | |
Keywords |
beaten path | main street | bread pudding | san francisco | paso robles | sammy | seating | ordered | counter | sophie | cambria | carmel | legion | noticed |

Domain name | technukes.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 09/07/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 12238481 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | |
Plugins | onesignal-free-web-push-notifications |
Keywords |
samsung galaxy s9 | samsung galaxy s10 | galaxy s10 | sierra leone | credit score | sixth | fourth | samsung | fruitful | noticed | digicam | blessed | mannequin | stated | rumor | cameras | powered | referred | telephones | storage |

Domain name | hypemediacompany.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 09/04/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 6770957 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | mesmerize |
Free theme | ![]() |
Plugins | mesmerize-companion |
contact-form-7 | |
Keywords |
online presence | brand story | noticed | nando | grill | examine | managing | competition | trouble |

Domain name | daytrippinwithleighmacfarlane.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 09/02/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | baskerville-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
Keywords |
art gallery | lake country | breaking bread | gallery | kelowna | rudolf | centre | kindness | okanagan | tells | chlorophyll | peachland | noticed | laughed | beeps | leaves | exhibit | shift | paintings | walked |

Domain name | avologieneoreviews.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 08/27/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | premier-child |
enfold | |
Free theme | ![]() |
Plugins | wp-customer-reviews |
siteorigin-panels | |
contact-form-7 | |
Keywords |
trade show | gold plating | medical devices | product works | younger | attendants | collagen | demonstration | closer | noticed | attended | promising | demonstrating |

Domain name | jennifercaress.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 08/22/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | |
Plugins | ie-sitemode |
Keywords |
tag archives | assembly required | instructions | chewy | punching | pieces | trial | nanny | shame | noticed | stared | river |

Domain name | thebronxseo.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 08/04/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Divi |
Free theme | ![]() |
Plugins | |
Keywords |
search engine optimization | seo team | york area | local area | bronx | numbers | hiring | noticed | optimize | competitors |

Domain name | dustinblogs.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 08/03/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | twentyfifteen |
Free theme | ![]() |
Plugins | jetpack |
Keywords |
pimple | pimples | meditation | sitting | noticed | meditate |

Domain name | foxexplains.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 07/26/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | patus |
Plugins | google-analytics-for-wordpress |
instagram-feed | |
amazon-associates-link-builder | |
jetpack | |
easymega | |
disqus-comment-system | |
Keywords |
prologue | seeds | feedback | walked | noticed | smiled | routine |

Domain name | letsliveyoga.com |
Votes | 6 ![]() ![]() ![]() |
Created on | 07/03/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 16178876 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | rima-child |
rima | |
Plugins | mailchimp |
open-in-new-window-plugin | |
add-to-any | |
rima-elements | |
mailchimp-for-wp | |
contact-form-7 | |
wp-megamenu | |
pinterest-pin-it-button-on-image-hover-and-post | |
Keywords |
care routine | moments | noticed | beginners |

Domain name | jrbryden.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 09/21/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | baskerville-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
custom-fonts | |
Keywords |
greater good | flash fiction | fucking | laughed | screamed | clowns | clown | noticed | crazy | breathing | funny | worse | scared | unable | knife | corruption | swarm | joined | suppose |
