Below is a collection of websites that have content with the purchased keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).
| Domain name | simplymiranda.com |
| Votes | 4   2  2 |
| Created on | 01/12/2018 |
| Google Analytics |  |
| Adsense |  |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value |   |
| Themes | genesis |
| prettychic | |
| Free theme | |
| Plugins | google-analyticator |
| bne-testimonials | |
| simple-social-icons | |
| cookie-notice | |
| jetpack | |
| social-pug | |
| contact-form-7 | |
| genesis-responsive-slider | |
| pinterest-pin-it-button-on-image-hover-and-post | |
| Keywords |
| save money | direct sales | ibotta | registry | receipt | ranger | pumpkins | coupons | primer | bananas | puppy | rebates | stores | purchased | cheap | throw |
| Domain name | indiafootballclub.com |
| Votes | 0 0 0 |
| Created on | 08/29/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentyseventeen |
| Free theme | |
| Plugins | strong-testimonials |
| megamenu | |
| revslider | |
| contact-form-7 | |
| js_composer | |
| Keywords |
| africa cup | world cup | football | soccer | sports | teams | hosted | sport | tickets | founded | purchased | winner | attend |
| Domain name | martinstormgenerator.com |
| Votes | 1 1 1 |
| Created on | 08/26/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | enfold |
| Free theme | |
| Plugins | contact-form-7 |
| Keywords |
| generator | generators | standard | functional | purchased |
| Domain name | boses1pro.com |
| Votes | 1 1 1 |
| Created on | 08/23/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 14464797 |
| Alexa backlinks | 1 |
| Site value | |
| Themes | twentyseventeen |
| Free theme | |
| Plugins | jetpack |
| Keywords |
| micro usb cable | audio | speaker | bluetooth | speakers | battery | purchased | inputs | seconds | ahead |
| Domain name | tinyredfruitwriter.com |
| Votes | 7 6 6 |
| Created on | 07/29/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | dara-wpcom |
| Plugins | jetpack |
| Keywords |
| blog site | thing called | previous site | comfort zone | event planner | amazing job | february 22 | writings | shuffle | purchased | navigate | scared | delighted | stepping | july 14 | exceeded | glimpse | expectations | loving | awareness |
| Domain name | theterribletwenties.com |
| Votes | 1 1 2 |
| Created on | 07/27/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentyseventeen |
| Free theme | |
| Plugins | google-analytics-for-wordpress |
| ultimate-social-media-icons | |
| Keywords |
| happy dog | string | template | purchased | raise | stain | significant |
| Domain name | poshsavings.com |
| Votes | 0 0 0 |
| Created on | 07/07/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | dara |
| Free theme | |
| Plugins | ie-sitemode |
| custom-fonts | |
| Keywords |
| sweepstakes | delivered | prize | winning | purchased |
| Domain name | infinitesabbatical.com |
| Votes | 2 1 1 |
| Created on | 07/07/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | genesis |
| twenty-seven-pro | |
| Free theme | |
| Plugins | jetpack |
| Keywords |
| bay area | rat race | primary residence | owning | downpayment | purchased | quitting | landlord |
| Domain name | sandiaparklabradors.com |
| Votes | 1 1 1 |
| Created on | 07/01/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 11022237 |
| Alexa backlinks | 1 |
| Site value | |
| Themes | boldgrid-evolv |
| Plugins | google-analytics-for-wordpress |
| post-and-page-builder | |
| Keywords |
| labrador retrievers | puppies | puppy | deposits | purchased | mexico | teddy | franklin | micah | retired | litter | progeny | fortunate | 8 weeks | attribution | 6 weeks | champions |
| Domain name | familyfriendlyreviewsandgiveaways.com |
| Votes | 1 3 1 |
| Created on | 05/30/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 16538533 |
| Alexa backlinks | - |
| Site value | |
| Themes | genesis |
| twenty-seven-pro | |
| Free theme | |
| Plugins | lightweight-social-icons |
| social-warfare | |
| Keywords |
| provide complete | chips | disclosure | giveaways | opinions | 3 boys | sponsorships | purchased | influenced | strictly | highlighters | strive | pencils |
| Domain name | traveltopido.com |
| Votes | 6 6 5 |
| Created on | 05/03/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | pbtheme |
| Plugins | profitbuilderpro1 |
| Keywords |
| service fees | vacation | taxes | reservations | purchased | hotels | booking | resorts | vendors | acknowledge | retain | facilitate |
| Domain name | meltthesolder.com |
| Votes | 4 1 1 |
| Created on | 09/28/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 1 |
| Site value | |
| Themes | rise |
| Plugins | contact-form-7 |
| thrive-visual-editor | |
| Keywords |
| soldering iron | ll notice | notable features | circuit board | soldering | irons | butane | weller | temperature | solder | devices | jewelry | pieces | electronics | complaints | commented | adjust | torch | purchased |
