Below is a collection of websites that have content with the purchased keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

Domain name | airlinechangeflights.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 05/20/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 2256070 |
Alexa backlinks | 2 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | travel-agency |
Plugins | wp-travel-engine |
easy-wp-cookie-popup | |
travel-agency-companion | |
contact-form-7 | |
Keywords |
price tag | travel agents | haul flight | checked baggage | airline | flights | ticket | baggage | tickets | flight | standby | cancellation | changing | modification | airport | itinerary | departure | purchased | passengers | charges |

Domain name | itsluluprice.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 08/20/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 15754927 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | pipdig-youandme |
Plugins | google-analytics-for-wordpress |
jetpack | |
Keywords |
good pair | american eagle | instagram stories | outfit | leggings | pants | jenna | target | nordstrom | tighter | retailers | waist | favorites | galentine | directly | purchased | clicking | sizes |

Domain name | portstluciehousebuyers.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 07/25/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 3892464 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | floridafast |
Plugins | |
Keywords |
real estate investor | cash offer | buy houses | house fast | purchased | listing | sellers | repairs | florida | 2 weeks |

Domain name | skwhee.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 07/07/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | moderne |
Plugins | jetpack |
Keywords |
civil war | ben & jerry | north | campground | camping | adventures | tonight | purchased | museum | memories | karen | arrived | afternoon | england | lived | evening | heading | trailer | maine | battle |

Domain name | portal-tek.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 06/25/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 12001979 |
Alexa backlinks | 3 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | twentyeleven |
Free theme | ![]() |
Plugins | google-analyticator |
Keywords |
portal | acquired | super | purchased |

Domain name | acupococo.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 06/23/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | crimson-rose |
Free theme | ![]() |
Plugins | google-analytics-for-wordpress |
insta-gallery | |
jetpack | |
wordpress-popular-posts | |
contact-form-7 | |
Keywords |
pigeon forge | ve decided | boutique | madison | teachers | teacher | purchased | clothing | campus | classes | harrisonburg | excuse |

Domain name | goingwhichway.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 06/17/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | veni |
Plugins | ie-sitemode |
Keywords |
working mum | north melbourne | articles filed | etsy shop | melbourne | knitting | mayday | imagined | queenstown | whiskey | visiting | purchased | teacup | inspiration | zealand | recall | alice |

Domain name | northyorkchryslerbadexperience.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 05/31/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | twentytwelve |
Free theme | ![]() |
Plugins | wp-customer-reviews |
sassy-social-share | |
Keywords |
loan application | extended warranty | sales person | google reviews | finance manager | bad experience | general manager | manager | engine | transmission | driving | complaint | dealership | truck | expenses | filed | requirement | purchased | filled | diagnostic |

Domain name | familyfriendlyreviewsandgiveaways.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 05/30/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 16538533 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | genesis |
twenty-seven-pro | |
Free theme | ![]() |
Plugins | lightweight-social-icons |
social-warfare | |
Keywords |
provide complete | chips | disclosure | giveaways | opinions | 3 boys | sponsorships | purchased | influenced | strictly | highlighters | strive | pencils |

Domain name | mykarens.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 05/27/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | independent-publisher-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
Keywords |
storage unit | building permit | big island | storage | hurricane | motorcycle | deeds | approval | complex | closing | arrived | apparently | strange | volcano | lived | documents | travels | marty | condo | purchased |

Domain name | osowebsites.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 05/25/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | generatepress |
Free theme | ![]() |
Plugins | gp-premium |
contact-form-7 | |
Keywords |
gmail account | email accounts | unlimited revisions | phone number | custom domain | setup | purchased | interface | revision | retaining | hosting |

Domain name | moderncontractorwebsites.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 09/12/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 9647418 |
Alexa backlinks | 2 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | mws_stacked |
generatepress | |
Free theme | ![]() |
Plugins | photofx |
wp-media-folder-addon | |
gp-premium | |
mystickysidebar | |
easy-pricing-tables-premium | |
mws-wowfx | |
mws-visual-columns | |
menu-icons | |
mws-form-builder | |
popup-builder-exit-intent | |
mws-contact-info | |
wp-show-posts | |
popup-builder-platinum | |
mws-popfx | |
mws-hoverfx | |
fx-editor | |
easy-fancybox | |
Keywords |
web page | highly recommend | business cards | website design | hosting | friendly | updates | awesome | compliments | wonderful | satisfied | willingness | purchased | angie | impressed | delivered | patience |
