Below is a collection of websites that have content with the trial keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).
| Domain name | hadparchitecture.com |
| Votes | 0   1  3 |
| Created on | 05/27/2018 |
| Google Analytics |  |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 2 |
| Site value |   |
| Themes | Avada |
| Free theme | |
| Plugins | wp-rocket |
| Keywords |
| fast internet | game resources | large quantity | free robux | roblox | instructions | robux | discovered | spotting | perusing | proceed | 5 ghz | trial | frustrating |
| Domain name | loomingart.com |
| Votes | 1 1 1 |
| Created on | 09/08/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentyseventeen |
| Free theme |  |
| Plugins | |
| Keywords |
| stay tuned | fine day | loops | tapestry | willingness | upload | winging | generous | hunger | nostalgia | iphone | sorts | interwebs | pictured | sparked | vocabulary | stumbled | drawn | sheds | trial |
| Domain name | dianeconstantine.com |
| Votes | 2 3 3 |
| Created on | 08/31/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 8470870 |
| Alexa backlinks | 3 |
| Site value | |
| Themes | ribosome |
| Plugins | add-to-any |
| photo-gallery | |
| Keywords |
| holy ground | boundaries | sabbath | touched | peter | sketch | drawer | extinction | wisdom | trial |
| Domain name | dynamicvoicekw.com |
| Votes | 4 4 5 |
| Created on | 08/28/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | thesis |
| Plugins | |
| Keywords |
| trial | seattle | invaluable | kimberly | attorney | skill | actors | freed | preparing | presentations | depositions |
| Domain name | ciociogrand.com |
| Votes | 2 2 4 |
| Created on | 08/22/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentyseventeen |
| Free theme | |
| Plugins | woocommerce |
| contact-form-7 | |
| Keywords |
| make mistakes | feel bad | ll find | fight depression | successful people | depression | anger | genius | angry | trial | depressed | parasites | therapist | struggles | afraid | isolate | uncategorized | secret | critical | recognize |
| Domain name | bluemoonmidnight.com |
| Votes | 3 3 5 |
| Created on | 08/03/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | goodnews-child |
| goodnews | |
| Plugins | advanced-recent-posts |
| wp-hide-post | |
| Keywords |
| popular works | vaccine | genre | trial | autophagy | evaluation | fiction | researchers | colleagues | metaphysics | moscow | pfeifer | species | stretches | target | literature | genres | proteins | fantasy | scientist |
| Domain name | criminaldefenselawyercedarrapids.com |
| Votes | 1 0 1 |
| Created on | 07/17/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 1 |
| Site value | |
| Themes | Divi |
| Free theme | |
| Plugins | |
| Keywords |
| cedar rapids | family law | crime | facing | charges | attorney | lawyer | dismissed | possession | custody | officer | evidence | represent | prison | charged | trial | probation | sentenced | counts | assault |
| Domain name | yvesbarbero.com |
| Votes | 2 2 3 |
| Created on | 07/12/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 7 |
| Site value | |
| Themes | nucleus |
| Plugins | auto-terms-of-service-and-privacy-policy |
| contact-form-7 | |
| newsletters-lite | |
| Keywords |
| camping trip | tents | camping | judge | returned | proceed | miles | overcome | trial | error |
| Domain name | texasabolitionists.com |
| Votes | 0 0 1 |
| Created on | 06/19/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | canard |
| Plugins | ie-sitemode |
| custom-fonts | |
| video | |
| Keywords |
| death row | death penalty | black men | texas | prison | slavery | justice | executions | execution | young | malik | prisons | houston | detention | prisoners | keith | governor | trial | appeals | executed |
| Domain name | greenszymanski.com |
| Votes | 0 0 0 |
| Created on | 06/19/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 12617694 |
| Alexa backlinks | 2 |
| Site value | |
| Themes | mwcoders |
| Plugins | easy-load-more |
| contact-form-7 | |
| Keywords |
| personal injury lawyers | insurance companies | medical malpractice | car accident | injury | accident | compensation | trial | police | entitled | caused | scene | prove | suffering |
| Domain name | palettepride.com |
| Votes | 0 1 0 |
| Created on | 06/05/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | innox |
| Plugins | instagram-feed |
| woocommerce | |
| mwt-addons | |
| unyson | |
| Keywords |
| wedding day | consultation | makeup | tasha | natasha | bride | friendly | trial | bridesmaids | responsive | minute |
| Domain name | ilovegwp.com |
| Votes | 1 1 1 |
| Created on | 09/13/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentytwelve |
| Free theme | |
| Plugins | |
| Keywords |
| category archives | affiliate links | coupon code | free trial | shade | trial | stores | colourpop | launching | supplies | refer | retail |
