Below is a collection of websites that have content with the shift keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).
| Domain name | bestnursinghomeinspection.com |
| Votes | 2   1  2 |
| Created on | 05/19/2018 |
| Google Analytics |  |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 1 |
| Site value |   |
| Themes | twentyfifteen |
| Free theme |  |
| Plugins | |
| Keywords |
| nursing home | nursing homes | minimum standards | standards | nurses | assessment | nurse | shift | legal | states | facility | albert | holidays | holiday | plantation | employer | resident |
| Domain name | daytrippinwithleighmacfarlane.com |
| Votes | 2 2 4 |
| Created on | 09/02/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | baskerville-2 |
| Free theme | |
| Plugins | ie-sitemode |
| Keywords |
| art gallery | lake country | breaking bread | gallery | kelowna | rudolf | centre | kindness | okanagan | tells | chlorophyll | peachland | noticed | laughed | beeps | leaves | exhibit | shift | paintings | walked |
| Domain name | yeseventlive.com |
| Votes | 2 3 4 |
| Created on | 08/29/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 11219103 |
| Alexa backlinks | - |
| Site value | |
| Themes | yespage |
| bb-theme | |
| Free theme | |
| Plugins | |
| Keywords |
| rancho palos verdes | bestselling author | lunch break | transformation | insecurities | shift | selfish | afraid | fears | accountable | confident | overcome | permission | possibility | abundance | speaking | pleasure | paradigm |
| Domain name | yourpurposefulnewlife.com |
| Votes | 3 3 2 |
| Created on | 08/14/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | twentyseventeen |
| Free theme | |
| Plugins | accesspress-social-icons |
| contact-form-7 | |
| Keywords |
| happy place | inspiring people | positive | brother | inspiring | shift | moments | empowering | privilege | inspiration | calling | version | mindset | possibilities | emotions | passionate | purposeful | serving | potential | inspire |
| Domain name | abtcargomovers.com |
| Votes | 2 1 1 |
| Created on | 08/13/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | hashone |
| Plugins | contact-form-7 |
| Keywords |
| dream car | industrial goods | specially designed | experienced personnel | relocation | storage | packers | movers | domestic | packing | destination | relocating | shifting | hassle | relocate | shift |
| Domain name | thesmilinghealer.com |
| Votes | 1 2 1 |
| Created on | 08/04/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | themify-ultra |
| Free theme | |
| Plugins | contact-form-7 |
| surveyslam | |
| page-scroll-to-id | |
| Keywords |
| Domain name | copes-capers.com |
| Votes | 0 0 0 |
| Created on | 07/16/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | independent-publisher-2 |
| Free theme | |
| Plugins | ie-sitemode |
| Keywords |
| colleagues | nurse | nursing | nurses | angels | shift |
| Domain name | facheforwarddesigns.com |
| Votes | 1 2 4 |
| Created on | 07/12/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | 2 |
| Site value | |
| Themes | lighthouse |
| Plugins | auto-terms-of-service-and-privacy-policy |
| contact-form-7 | |
| Keywords |
| back support | sore muscles | side sleeper | good sleep | comfortable sleep | mattress topper | pillow | mattresses | sleeping | mattress | floral | topper | flowers | vital | designer | interior | picking | numbness | spine | shift |
| Domain name | cateblackmore.com |
| Votes | 4 3 3 |
| Created on | 07/02/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | photography |
| Plugins | ie-sitemode |
| Keywords |
| gold leaf | mixed media | paintings | tribute | exhibition | wonderful | tasmania | collage | landscape | experimentation | pastel | texture | hobart | shift | studio | painting |
| Domain name | businesstargeting.com |
| Votes | 2 2 2 |
| Created on | 06/18/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | 17120429 |
| Alexa backlinks | 1 |
| Site value | |
| Themes | Divi |
| Free theme | |
| Plugins | divi-builder |
| megamenu | |
| onesignal-free-web-push-notifications | |
| Keywords |
| column padding | text font | top padding | bottom padding | width | padding | pixel | headphones | photography | improving | pocket | shift |
| Domain name | tenderember.com |
| Votes | 1 2 1 |
| Created on | 06/09/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | spatial |
| Plugins | ie-sitemode |
| custom-fonts | |
| Keywords |
| full moon | incense | dreaming | capricorn | scent | direct | challenges | acknowledge | virgo | shift |
| Domain name | thedigitaltides.com |
| Votes | 2 1 2 |
| Created on | 09/02/2018 |
| Google Analytics | |
| Adsense | |
| Amazon Affiliate | |
| Alexa rank | - |
| Alexa backlinks | - |
| Site value | |
| Themes | intergalactic-2 |
| Free theme | |
| Plugins | ie-sitemode |
| Keywords |
| digital world | digital transformation | transformation | adele | processes | creator | lights | engage | shift | joining |
