Below is a collection of websites that have content with the prison keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

Domain name | bridgewateranniversary.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 05/11/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Divi |
TechBear | |
Free theme | ![]() |
Plugins | revslider |
Keywords |
mental illness | massachusetts department | bridgewater | hospital | restraint | correction | facilities | oriented | facility | persons | trauma | recovery | seclusion | instituted | administration | prison |

Domain name | thefilmfury.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 09/01/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 6256914 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | genesis |
magazine-pro | |
Free theme | ![]() |
Plugins | google-analytics-for-wordpress |
simple-social-icons | |
jetpack | |
social-warfare | |
gutenberg | |
Keywords |
good movie | true story | movie night | movies | rocky | filed | woodlawn | prison | december | viewers | january | survive |

Domain name | criminaldefenselawyercedarrapids.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 07/17/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Divi |
Free theme | ![]() |
Plugins | |
Keywords |
cedar rapids | family law | crime | facing | charges | attorney | lawyer | dismissed | possession | custody | officer | evidence | represent | prison | charged | trial | probation | sentenced | counts | assault |

Domain name | cagedgourmet.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 07/12/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | twentyfifteen |
Free theme | ![]() |
Plugins | |
Keywords |
prison | chapter | oregon | inmates | depressing | breaking | transferred | inmate | chains | meals |

Domain name | movies-buddy.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 06/28/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 15724810 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | PsyPlay 1.1.7 |
Plugins | wp-postratings |
Keywords |
world war ii | science fiction | high school | los angeles | complaining party | young | comedy | secret | crime | begins | missing | escape | genre | mystery | actors | quest | strange | brother | battle | prison |

Domain name | hempcbdoilforsale.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 06/19/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Divi |
Free theme | ![]() |
Plugins | |
Keywords |
medical marijuana | high times | gun control | medical cannabis | opioid abuse | marijuana | cholesterol | veterans | department | cannabis | webby | louisiana | winslow | transplant | diseases | legalization | illinois | colorado | oregon | prison |

Domain name | cdbusinessmall.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 06/19/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | magazine-hoot |
Plugins | contact-form-7 |
gdpr-cookie-compliance | |
Keywords |
intellectual property rights | credit card | gossip cop | rights reserved | priyanka chopra | getty images | give birth | oldest person | trump | jolie | greyhounds | bitcoin | texas | economic | thursday | lawyer | transactions | edogbone | prison | dickson |

Domain name | thesneakcheat.com |
Votes | 8 ![]() ![]() ![]() |
Created on | 06/09/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | independent-publisher-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
Keywords |
port arthur | kangaroo island | penguins | prison | platypus | drove | trail | climbers | steven | walked | rocks | wombats | wombat | headed | prisoners | watched | campsite | convicts | reached | tasmania |

Domain name | cillacritic.com |
Votes | 4 ![]() ![]() ![]() |
Created on | 06/03/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 7395835 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | salient |
Free theme | ![]() |
Plugins | js_composer_salient |
email-subscribers | |
contact-form-7 | |
Keywords |
song titled | record label | negative energy | good music | love stories | uyo meyo | make music | drama queen | album review | independent artist | nigerian | artist | wonderful | telling | discusses | davido | lyrics | independent | elements | prison |

Domain name | planethopeful.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 05/31/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | twentyseventeen |
Free theme | ![]() |
Plugins | contact-form-7 |
Keywords |
god bless america | eternal life | god bless | brighter tomorrow | holy night | silent night | amazing grace | jesus christ | christ jesus | hopeful | planet | bless | forever | bible | jesus | grace | celebrate | hopeless | prison | neighbor |

Domain name | iranlatestnews.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 05/18/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | supermag |
Plugins | |
Keywords |
human rights | security forces | islamic republic | solitary confinement | tehran university | activists | prison | tehran | prisoner | protests | detained | detainees | charges | unknown | reported | arrested | torture | mandate | execution | executed |

Domain name | ahmedbinqasim.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 09/10/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 18050670 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | independent-publisher-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
custom-fonts | |
Keywords |
occupation | muhammad | kashmir | prison | birth | birthday | orphan |
