Below is a collection of websites that have content with the exhibit keyword.
These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

Domain name | blockscientific.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 05/21/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 1415710 |
Alexa backlinks | 37 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | MOS |
Plugins | subscribe-sidebar |
LayerSlider | |
contact-form-7 | |
myMail | |
Keywords |
lab equipment | laboratory equipment | linked sites | toll free | accurate results | leading manufacturers | manufacturers | reagents | inventory | lease | siemens | tests | consumables | exhibit | controls | specifications |

Domain name | daytrippinwithleighmacfarlane.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 09/02/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | baskerville-2 |
Free theme | ![]() |
Plugins | ie-sitemode |
Keywords |
art gallery | lake country | breaking bread | gallery | kelowna | rudolf | centre | kindness | okanagan | tells | chlorophyll | peachland | noticed | laughed | beeps | leaves | exhibit | shift | paintings | walked |

Domain name | gcpconnections.com |
Votes | 4 ![]() ![]() ![]() |
Created on | 09/01/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Avada |
Free theme | ![]() |
Plugins | LayerSlider |
captcha | |
google-language-translator | |
jetpack | |
revslider | |
Keywords |
chinese market | business development | miami | distributors | seattle | offices | exhibit | november 2018 | meetings | zhuhai | decades | january 2019 | sides |

Domain name | bobbybeignettravels.com |
Votes | 4 ![]() ![]() ![]() |
Created on | 08/05/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | hemingway-rewritten |
Plugins | ie-sitemode |
custom-fonts | |
Keywords |
andrew jackson | nova scotia | mississippi river | crawfish | louisiana | plantation | swamp | statue | exhibit | slaves | orleans | battle | swamps | ships | celebrate | killed |

Domain name | lasvegastradeshowcompany.com |
Votes | 0 ![]() ![]() ![]() |
Created on | 07/17/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | mise-pro |
Plugins | wp-rocket |
Keywords |
trade show booth | trade shows | las vegas | business model | exhibit | inline | booth | captures | exhibitors | david | outstanding | exhibitor | chicago | customize | dismantle | represented | miami | orlando | headquarters |

Domain name | nmcguirestudio.com |
Votes | 10 ![]() ![]() ![]() |
Created on | 07/14/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | 2 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | wwwr.us |
photocrati-pro | |
Plugins | google-analytics-for-wordpress |
jetpack | |
Keywords |
saint paul | april 8th | february 1st | estes park | january 26th | early february | 7th street | great collection | artwork | hopkins | canvas | exhibit | brainerd | pieces | collectors | samples | october 12 | sizes | favorite | ramsey |

Domain name | generationyuk.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 07/12/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 6408200 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | marigold-blog |
Plugins | google-captcha |
mailchimp-for-wp | |
contact-form-7 | |
the-events-calendar | |
Keywords |
ice cream | dog sledding | san diego | aurora borealis | york city | parking | favorite | glacier | waterfall | weather | blackheads | magic | exhibit | strip | broadway | luckily | booked | plane | iceland | describe |

Domain name | ee-arabia.com |
Votes | 2 ![]() ![]() ![]() |
Created on | 07/07/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 17994926 |
Alexa backlinks | 1 |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | eplano |
Plugins | logo-slider-wp |
wp-counter-up | |
vcx-theme-core | |
contact-form-7 | |
js_composer | |
Keywords |
saudi arabia | entertainment industry | exhibitions | exhibit | entertainment | featured | kingdom | demands | opportunities |

Domain name | coursesandcareerpath.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 07/06/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | donovan |
Plugins | godaddy-email-marketing-sign-up-forms |
Keywords |
basic sciences | career path | career opportunities | young women | union minister | professional courses | courses | careers | examinations | exhibit | chances | mains | innovations | merits | participate | opening | fellowship | score | crack | mathematics |

Domain name | shipyardart.com |
Votes | 1 ![]() ![]() ![]() |
Created on | 06/27/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | 16170556 |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | oceanwp |
Free theme | ![]() |
Plugins | ocean-extra |
elementor | |
woo-variation-swatches | |
cg-pro-prints | |
woo-wallet | |
ocean-elementor-widgets | |
contact-form-7 | |
ocean-social-sharing | |
jetpack | |
woocommerce | |
woocommerce-gateway-paypal-express-checkout | |
woo-variation-gallery | |
ocean-sticky-header | |
Keywords |
acrylic paints | creative spirit | exhibit | marblehead | mixed | artists | force | boston | juried | canvas | mediums | shadow | gallery | engage | september 29 | september 23 |

Domain name | paxjakupajr.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 05/24/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Sky |
Plugins | |
Keywords |
ten years | running water | highlands | responsibilities | exhibit | previous | electricity | guinea | museum | washed | daytime | destroyed | vancouver | symposium | reminder | anthropology | papua | doorway |

Domain name | wingluke-temp.com |
Votes | 3 ![]() ![]() ![]() |
Created on | 09/06/2018 |
Google Analytics | ![]() |
Adsense | ![]() |
Amazon Affiliate | ![]() |
Alexa rank | - |
Alexa backlinks | - |
Site value | ![]() ![]() ![]() ![]() ![]() |
Themes | Divi |
Free theme | ![]() |
Plugins | my-calendar |
contact-form-7 | |
Keywords |
oral histories | special offers | king st | day pass | 7th ave | museum | exhibit | partnership | bruce | schools | classroom | chinatown | seattle | 3 blocks | galleries | combined | regular | environments | memberships | prearranged |
